FXYD3 Polyclonal antibody

FXYD3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15853-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Chloride conductance inducer protein Mat-8, FXYD domain-containing ion transport regulator 3, Mammary tumor 8 kDa protein, MAT 8, MAT8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, COLO 320 cells, SGC-7901 cells, A431 cells, BxPC-3 cells, FaDu cells, HaCaT cells, MCF-7 cells, RT-4 cells, ScaBER cells, SK-BR-3 cells
Positive IP detected inCOLO 320 cells
Positive IHC detected inhuman breast cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15853-1-AP targets FXYD3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8672

Product name: Recombinant human FXYD3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC005238

Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS

Predict reactive species
Full Name FXYD domain containing ion transport regulator 3
Calculated Molecular Weight 87 aa, 9 kDa
Observed Molecular Weight 8-10 kDa
GenBank Accession NumberBC005238
Gene Symbol FXYD3
Gene ID (NCBI) 5349
RRIDAB_2108602
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14802
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD3 (also known as Mat-8) is one of the seven members of Fxyd3 protein family, belonging to a small molecular auxiliary subunit with single transmembrane, and its extracellular segment contains conservative Fxyd3 sequence motifs. By combining the α/β catalytic core of Na/K-ATPase, this family can finely adjust the ionic affinity and kinetics of the pump in different tissues, cell types and physiological states, without affecting the overall expression of the enzyme. It is mainly expressed in stomach, colon, pancreas, prostate, skin and other epithelium, showing obvious tissue specificity, and is significantly up-regulated in breast cancer, pancreatic cancer, colorectal cancer, prostate cancer, renal cell cancer, cholangiocarcinoma and psoriasis lesions, and is related to disease progression and chemotherapy resistance.

Protocols

Product Specific Protocols
IHC protocol for FXYD3 antibody 15853-1-APDownload protocol
IP protocol for FXYD3 antibody 15853-1-APDownload protocol
WB protocol for FXYD3 antibody 15853-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...