Tested Applications
Positive IHC detected in | human renal cell carcinoma tissue, mouse testis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
11966-1-AP targets FXYD4 in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2576 Product name: Recombinant human FXYD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC054876 Sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC Predict reactive species |
Full Name | FXYD domain containing ion transport regulator 4 |
Calculated Molecular Weight | 89 aa, 10 kDa |
GenBank Accession Number | BC054876 |
Gene Symbol | FXYD4 |
Gene ID (NCBI) | 53828 |
RRID | AB_2108604 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P59646 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for FXYD4 antibody 11966-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |