FXYD4 Polyclonal antibody

• 

  IHC staining of human renal cell carcinoma using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 11966-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11966-1-AP (FXYD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FXYD4 Polyclonal Antibody for IHC, ELISA

Cat No. 11966-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

CHIF, FXYD4

---

Tested Applications

• Positive IHC detected in: human renal cell carcinoma tissue, mouse testis tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

11966-1-AP targets FXYD4 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2576

  Product name: Recombinant human FXYD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC054876

  Sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC

• Full Name: FXYD domain containing ion transport regulator 4
• Calculated Molecular Weight: 89 aa, 10 kDa
• GenBank Accession Number: BC054876
• Gene Symbol: FXYD4
• Gene ID (NCBI): 53828
• RRID: AB_2108604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59646
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	J Hazard Mater; Insight into perfluorooctanoic acid-induced impairment of mouse embryo implantation via single-cell RNA-seq; Authors - Xiaoqiang Sheng