Product Information
60111-1-Ig targets FXYD6 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8538 Product name: Recombinant human FXYD6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-95 aa of BC018652 Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 6 |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| GenBank Accession Number | BC018652 |
| Gene Symbol | FXYD6 |
| Gene ID (NCBI) | 53826 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H0Q3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |

