• Featured Product
  • KD/KO Validated

FXYD6 Monoclonal antibody

FXYD6 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68058-1-Ig
Clone No.2H1B7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, ELISA

2H1B7, FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, COLO 320 cells, rat cerebellum tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue
Positive IHC detected inmouse cerebellum tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68058-1-Ig targets FXYD6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8538

Product name: Recombinant human FXYD6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-95 aa of BC018652

Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Predict reactive species
Full Name FXYD domain containing ion transport regulator 6
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC018652
Gene Symbol FXYD6
Gene ID (NCBI) 53826
RRIDAB_2918799
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H0Q3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.

Protocols

Product Specific Protocols
IF protocol for FXYD6 antibody 68058-1-IgDownload protocol
IHC protocol for FXYD6 antibody 68058-1-IgDownload protocol
WB protocol for FXYD6 antibody 68058-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...