• Featured Product
  • KD/KO Validated

FXYD6 Monoclonal antibody, PBS Only (Capture)

FXYD6 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68058-1-PBS
Clone No.2H1B7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

2H1B7, FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68058-1-PBS targets FXYD6 as part of a matched antibody pair:

MP51485-1: 68058-1-PBS capture and 68058-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8538

Product name: Recombinant human FXYD6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-95 aa of BC018652

Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Predict reactive species
Full Name FXYD domain containing ion transport regulator 6
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC018652
Gene Symbol FXYD6
Gene ID (NCBI) 53826
RRIDAB_2918799
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H0Q3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.

Loading...
||
New chat Able
正在加载,请稍候...