FXYD6 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 68058-1-Ig (same clone as 68058-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68058-1-Ig (FXYD6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68058-1-Ig (same clone as 68058-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68058-1-Ig (FXYD6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68058-1-Ig (FXYD6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 68058-1-Ig (same clone as 68058-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using FXYD6 antibody (68058-1-Ig, Clone: 2H1B7 ) at dilution of 1:1000 and CoraLite®594-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-3). This data was developed using the same antibody clone with 68058-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51485-1

  Cytometric bead array sample test of MP51485-1, FXYD6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68058-1-PBS. Detection antibody: 68058-2-PBS.

• 

  Cytometric bead array standard curve of MP51485-1

  Cytometric bead array standard curve of MP51485-1, FXYD6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68058-1-PBS. Detection antibody: 68058-2-PBS. Standard:Ag8538. Range: 0.781-100 ng/mL.

FXYD6 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68058-1-PBS

Clone No.2H1B7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

2H1B7, FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056

---

Product Information

68058-1-PBS targets FXYD6 as part of a matched antibody pair:

MP51485-1: 68058-1-PBS capture and 68058-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8538

  Product name: Recombinant human FXYD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-95 aa of BC018652

  Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

• Full Name: FXYD domain containing ion transport regulator 6
• Calculated Molecular Weight: 95 aa, 11 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC018652
• Gene Symbol: FXYD6
• Gene ID (NCBI): 53826
• RRID: AB_2918799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0Q3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.