FXYD7 Polyclonal antibody

FXYD7 Polyclonal Antibody for WB, ELISA
Cat No. 11465-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

FXYD7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11465-1-AP targets FXYD7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2030

Product name: Recombinant human FXYD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC018619

Sequence: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV

Predict reactive species
Full Name FXYD domain containing ion transport regulator 7
Calculated Molecular Weight 9 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC018619
Gene Symbol FXYD7
Gene ID (NCBI) 53822
RRIDAB_2108627
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP58549
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD7 (FXYD domain containing ion transport regulator 7) is a single-pass membrane protein that belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Expressed exclusively in the brain, FXYD7 is an isoform-specific Na,K-ATPase regulator which could play an important role in neuronal excitability. It has been reported that FXYD7 bears post-translationally added modifications on threonine residues and has an apparent molecular weight of 18 kDa (PMID: 12093728).

Protocols

Product Specific Protocols
WB protocol for FXYD7 antibody 11465-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...