Tested Applications
Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11465-1-AP targets FXYD7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2030 Product name: Recombinant human FXYD7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018619 Sequence: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV Predict reactive species |
Full Name | FXYD domain containing ion transport regulator 7 |
Calculated Molecular Weight | 9 kDa |
Observed Molecular Weight | 18-20 kDa |
GenBank Accession Number | BC018619 |
Gene Symbol | FXYD7 |
Gene ID (NCBI) | 53822 |
RRID | AB_2108627 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P58549 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FXYD7 (FXYD domain containing ion transport regulator 7) is a single-pass membrane protein that belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Expressed exclusively in the brain, FXYD7 is an isoform-specific Na,K-ATPase regulator which could play an important role in neuronal excitability. It has been reported that FXYD7 bears post-translationally added modifications on threonine residues and has an apparent molecular weight of 18 kDa (PMID: 12093728).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FXYD7 antibody 11465-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |