Fascin Monoclonal antibody, PBS Only

• 

  WB analysis of SH-SY5Y using 66321-1-Ig (same clone as 66321-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66321-1-Ig (Fascin Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 66321-1-Ig (same clone as 66321-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 66321-1-Ig (Fascin Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66321-1-Ig (same clone as 66321-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66321-1-Ig (Fascin Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66321-1-Ig (Fascin antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66321-1-Ig (Fascin Antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 66321-1-Ig (Fascin antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using Fascin antibody (66321-1-Ig, Clone: 1B5G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 66321-1-Ig (same clone as 66321-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed SH-SY5Y cells using 66321-1-Ig(Fascin antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 66321-1-Ig (same clone as 66321-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Fascin Monoclonal antibody (66321-1-Ig, Clone:1B5G3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66321-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Fascin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 66321-1-PBS

Clone No.1B5G3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

FSCN1, 1B5G3, 55 kDa actin bundling protein, 55 kDa actin-bundling protein, Fascin 1,Fascin

---

Product Information

66321-1-PBS targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6074

  Product name: Recombinant human Fascin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC000521

  Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS

• Full Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC000521
• Gene Symbol: Fascin
• Gene ID (NCBI): 6624
• ENSEMBL Gene ID: ENSG00000075618
• RRID: AB_2881701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16658
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.