Fibromodulin Polyclonal antibody, PBS Only

• 

  WB analysis of human liver using 13281-1-AP (same clone as 13281-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13281-1-AP (Fibromodulin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13281-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13281-1-AP (same clone as 13281-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Fibromodulin antibody (13281-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13281-1-PBS in a different storage buffer formulation.

Fibromodulin Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 13281-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FMOD, Collagen-binding 59 kDa protein, FM, Keratan sulfate proteoglycan fibromodulin, KSPG fibromodulin

---

Product Information

13281-1-PBS targets Fibromodulin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4030

  Product name: Recombinant human FMOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC035281

  Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

• Full Name: fibromodulin
• Calculated Molecular Weight: 376 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC035281
• Gene Symbol: Fibromodulin
• Gene ID (NCBI): 2331
• RRID: AB_2105531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06828
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).