Flotillin 2 Polyclonal antibody, PBS Only

• 

  WB analysis using 28208-1-AP (same clone as 28208-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28208-1-AP (Flotillin 2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28208-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28208-1-AP (same clone as 28208-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28208-1-AP (Flotillin 2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28208-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28208-1-AP (same clone as 28208-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Flotillin 2 antibody (28208-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28208-1-PBS in a different storage buffer formulation.

Flotillin 2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28208-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FLOT2, Flotillin-2, ECS 1, ECS1, Epidermal surface antigen

---

Product Information

28208-1-PBS targets Flotillin 2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28308

  Product name: Recombinant human Flotillin 2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-379 aa of BC017292

  Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV

• Full Name: flotillin 2
• Calculated Molecular Weight: 379 aa, 42 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC017292
• Gene Symbol: Flotillin 2
• Gene ID (NCBI): 2319
• RRID: AB_2881089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14254
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Flotillins are membrane-associated proteins that contain two homologous isoforms, flotillin 1 (FLOT1) and flotillin 2 (FLOT2). They are highly conserved and widely expressed proteins that commonly used as markers of lipid rafts. Flotillins are involved in various signaling pathways, cell adhesion, membrane trafficking and axonal growth.