Tested Applications
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 13 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
12091-1-AP targets G0S2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2731 Product name: Recombinant human G0S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC009694 Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS Predict reactive species |
| Full Name | G0/G1switch 2 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC009694 |
| Gene Symbol | G0S2 |
| Gene ID (NCBI) | 50486 |
| RRID | AB_2877824 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P27469 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
G0S2 is G0/G1 switch protein 2. It is an all trans- retinoic acid (RA) target gene. G0S2 promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for G0S2 antibody 12091-1-AP | Download protocol |
| IHC protocol for G0S2 antibody 12091-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Res Bcl-xL enforces a slow-cycling state necessary for survival in the nutrient-deprived microenvironment of pancreatic cancer. | ||
J Clin Endocrinol Metab Endurance exercise training up-regulates lipolytic proteins and reduces triglyceride content in skeletal muscle of obese subjects. | ||
Genomics MIN score predicts primary response to infliximab/adalimumab and vedolizumab therapy in patients with inflammatory bowel diseases. | ||
J Clin Endocrinol Metab Moderate-Intensity Exercise and High-Intensity Interval Training Affect Insulin Sensitivity Similarly in Obese Adults. | ||
Mol Metab G0/G1 Switch Gene 2 controls adipose triglyceride lipase activity and lipid metabolism in skeletal muscle.
| ||





