Product Information
66860-4-PBS targets G6PC as part of a matched antibody pair:
MP50826-2: 66860-4-PBS capture and 66860-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17839 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC130478 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK Predict reactive species |
Full Name | glucose-6-phosphatase, catalytic subunit |
Calculated Molecular Weight | 357 aa, 40 kDa |
GenBank Accession Number | BC130478 |
Gene Symbol | G6PC |
Gene ID (NCBI) | 2538 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P35575 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |