Tested Applications
Positive WB detected in | Jurkat cells, A375 cells, HEK-293 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
IP | See 1 publications below |
Product Information
20870-1-AP targets GABPB2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14933 Product name: Recombinant human GABPB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 129-220 aa of BC027033 Sequence: DVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNS Predict reactive species |
Full Name | GA binding protein transcription factor, beta subunit 2 |
Calculated Molecular Weight | 448 aa, 49 kDa |
Observed Molecular Weight | 49 kDa |
GenBank Accession Number | BC027033 |
Gene Symbol | GABPB2 |
Gene ID (NCBI) | 126626 |
RRID | AB_10734321 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TAK5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GABPB2 is a subunit of the GA-binding protein (GABP) transcription factor, which is a heterodimeric complex. The GABP complex plays a role in the regulation of gene transcription by binding to specific DNA sequences. GABPB2 specifically contributes to the transactivation of target genes (PMID: 18628204). The protein is primarily located in the nucleus. It is ubiquitously expressed in various tissues, including testis, ovary, and others. Studies have shown that GABPB2 is dispensable for normal lymphocyte development but moderately affects B cell responses (PMID: 18628204). Mice deficient in GABPB2 exhibit increased B cell proliferation and antibody production in response to certain stimuli. The molecular weight of GABPB2 is 48 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GABPB2 antibody 20870-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |