Tested Applications
Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21766-1-AP targets GABRA6 in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16375 Product name: Recombinant human GABRA6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 329-424 aa of BC096241 Sequence: NLQTQKAKRKAQFAAPPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRIL Predict reactive species |
Full Name | gamma-aminobutyric acid (GABA) A receptor, alpha 6 |
Calculated Molecular Weight | 453 aa, 51 kDa |
GenBank Accession Number | BC096241 |
Gene Symbol | GABRA6 |
Gene ID (NCBI) | 2559 |
RRID | AB_3085671 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16445 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABAA receptors, which are ligand-gated chloride channels. GABAA receptors are formed by pentameric assembly of 19 different subunit subtypes (α1-α6, β1-β3, γ1-γ3, δ, ɛ, π, θ and ρ1-ρ3) (PMID: 21930603). The mutation R46W of GABRA6 is associated with the pathogenesis of childhood absence epilepsy (CAE) (PMID: 21930603).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GABRA6 antibody 21766-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |