Product Information
22645-1-AP targets GADD45B in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18524 Product name: Recombinant human GADD45B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-160 aa of BC113466 Sequence: VRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER Predict reactive species |
Full Name | growth arrest and DNA-damage-inducible, beta |
Calculated Molecular Weight | 160 aa, 18 kDa |
GenBank Accession Number | BC113466 |
Gene Symbol | GADD45B |
Gene ID (NCBI) | 4616 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | O75293 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |