Product Information
22645-1-AP targets GADD45B in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18524 Product name: Recombinant human GADD45B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-160 aa of BC113466 Sequence: VRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER Predict reactive species |
| Full Name | growth arrest and DNA-damage-inducible, beta |
| Calculated Molecular Weight | 160 aa, 18 kDa |
| GenBank Accession Number | BC113466 |
| Gene Symbol | GADD45B |
| Gene ID (NCBI) | 4616 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O75293 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
