GAGE5 Polyclonal antibody

• 

GAGE5 Polyclonal Antibody for ELISA

Cat No. 13185-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Cancer/testis antigen 4.5, CT4.5, G antigen 5, GAGE 5, GAGE5

---

Product Information

13185-1-AP targets GAGE5 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3857

  Product name: Recombinant human GAGE5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC024914

  Sequence: MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

• Full Name: G antigen 5
• Calculated Molecular Weight: 117 aa, 13 kDa
• GenBank Accession Number: BC024914
• Gene Symbol: GAGE5
• Gene ID (NCBI): 2577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13069
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.