GAGE7 Polyclonal antibody

• 

  IHC staining of human prostate cancer using 12945-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 12945-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human gliomas using 12945-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human gliomas using 12945-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 40x lens).

GAGE7 Polyclonal Antibody for IHC, ELISA

Cat No. 12945-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

GAGE 12I, G antigen 7, G antigen 12F, CT4.7, Cancer/testis antigen 4.7

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

12945-1-AP targets GAGE7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4018

  Product name: Recombinant human GAGE7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC031628

  Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

• Full Name: G antigen 7
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC031628
• Gene Symbol: GAGE7
• Gene ID (NCBI): 2579
• RRID: AB_2877895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76087
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Cancer Res Clin Oncol; Elevated ZBTB7A expression in the tumor invasive front correlates with more tumor budding formation in gastric adenocarcinoma.; Authors - Yujing Sun
human	WB,IHC	J Exp Clin Cancer Res; GAGE7B promotes tumor metastasis and growth via activating the p38δ/pMAPKAPK2/pHSP27 pathway in gastric cancer.; Authors - Duan-Bo Shi