Galanin Polyclonal antibody

• 

  IHC staining of human pituitary adenoma using 13307-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 13307-1-AP (Galanin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary adenoma using 13307-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 13307-1-AP (Galanin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Galanin Polyclonal Antibody for IHC, ELISA

Cat No. 13307-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

GAL, GAL1, Galanin, galanin prepropeptide, GALN, GLNN, GMAP

---

Tested Applications

• Positive IHC detected in: human pituitary adenoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13307-1-AP targets Galanin in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4136

  Product name: Recombinant human GAL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-123 aa of BC030241

  Sequence: LWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

• Full Name: galanin prepropeptide
• Calculated Molecular Weight: 123 aa, 13 kDa
• GenBank Accession Number: BC030241
• Gene Symbol: GAL
• Gene ID (NCBI): 51083
• RRID: AB_3085412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22466
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galanin is a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system