GAL3ST4 Polyclonal antibody, PBS Only

• 

  WB analysis of human placenta using 16240-1-AP (same clone as 16240-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A2780 using 16240-1-AP (same clone as 16240-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 16240-1-AP (same clone as 16240-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16240-1-PBS in a different storage buffer formulation.

GAL3ST4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16240-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16240-1-PBS targets GAL3ST4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9063

  Product name: Recombinant human GAL3ST4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 136-486 aa of BC012976

  Sequence: HMRFNLKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLLWFDFGLPFPPEKRAKRGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFDLGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDVKQFPPTVSLPLKTSRPLSP

• Full Name: galactose-3-O-sulfotransferase 4
• Calculated Molecular Weight: 486 aa, 54 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC012976
• Gene Symbol: GAL3ST4
• Gene ID (NCBI): 79690
• RRID: AB_2294471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RP7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.