GAP43 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87287-1-RR (same clone as 87287-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87287-1-RR (GAP43 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87287-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87287-1-RR (same clone as 87287-1-PBS)

  Fetal human brain tissue was subjected to SDS PAGE followed by western blot with 87287-1-RR (GAP43 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87287-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 87287-1-RR (same clone as 87287-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 87287-1-RR (GAP43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87287-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 87287-1-RR (same clone as 87287-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using GAP43 antibody (87287-1-RR, Clone: 252373G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87287-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 87287-1-RR (same clone as 87287-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using GAP43 antibody (87287-1-RR, Clone: 252373G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87287-1-PBS in a different storage buffer formulation.

GAP43 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 87287-1-PBS

Clone No.252373G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

Axonal membrane protein GAP 43, Axonal membrane protein GAP-43, B 50, growth associated protein 43, Growth-associated protein 43

---

Product Information

87287-1-PBS targets GAP43 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9294

  Product name: Recombinant human GAP43 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-238 aa of BC007936

  Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

• Full Name: growth associated protein 43
• Calculated Molecular Weight: 238 aa, 25 kDa
• Observed Molecular Weight: 43-45 kDa
• GenBank Accession Number: BC007936
• Gene Symbol: GAP43
• Gene ID (NCBI): 2596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17677
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The neuronal growth-associated protein GAP43 is known as neuromodulin, B-50, P-57, F1, and pp46. Deficiency of GAP43 in mice results in death early in the postnatal period. GAP43 is one of the main substrates for protein kinase C in the brain. GAP43 is an intracellular growth-associated protein that appears to assist neuronal pathfinding and branching during development and regeneration and may contribute to presynaptic membrane changes in the adult, leading to neurotransmitter release, endocytosis, and synaptic vesicle recycling, long-term potentiation, spatial memory formation, and learning. The predicted molecular weight of about 25 kDa is much lower than the apparent observed molecular weight of 43 kDa on SDS-PAGE gels, and this occurs because the highly charged nature of GAP43 causes it to bind less than the average amount of SDS per amino acid, and because the protein has an elongated structure.