GAP43 Recombinant monoclonal antibody

GAP43 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IF-P, ELISA
Cat No. 87287-1-RR
Clone No.252373G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IF-P, ELISA

Axonal membrane protein GAP 43, Axonal membrane protein GAP-43, B 50, growth associated protein 43, Growth-associated protein 43

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, fetal human brain tissue, mouse brain tissue, rat brain tissue
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87287-1-RR targets GAP43 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9294

Product name: Recombinant human GAP43 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-238 aa of BC007936

Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Predict reactive species
Full Name growth associated protein 43
Calculated Molecular Weight 238 aa, 25 kDa
Observed Molecular Weight 43-45 kDa
GenBank Accession NumberBC007936
Gene Symbol GAP43
Gene ID (NCBI) 2596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17677
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The neuronal growth-associated protein GAP43 is known as neuromodulin, B-50, P-57, F1, and pp46. Deficiency of GAP43 in mice results in death early in the postnatal period. GAP43 is one of the main substrates for protein kinase C in the brain. GAP43 is an intracellular growth-associated protein that appears to assist neuronal pathfinding and branching during development and regeneration and may contribute to presynaptic membrane changes in the adult, leading to neurotransmitter release, endocytosis, and synaptic vesicle recycling, long-term potentiation, spatial memory formation, and learning. The predicted molecular weight of about 25 kDa is much lower than the apparent observed molecular weight of 43 kDa on SDS-PAGE gels, and this occurs because the highly charged nature of GAP43 causes it to bind less than the average amount of SDS per amino acid, and because the protein has an elongated structure.

Protocols

Product Specific Protocols
IF protocol for GAP43 antibody 87287-1-RRDownload protocol
IHC protocol for GAP43 antibody 87287-1-RRDownload protocol
WB protocol for GAP43 antibody 87287-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...