GATA3 Recombinant monoclonal antibody

GATA3 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), ELISA, ChIP-qPCR
Cat No. 83808-2-RR
Clone No.240684B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA, ChIP-qPCR

240684B8, GATA binding factor 3, GATA-binding factor 3, Trans-acting T-cell-specific transcription factor GATA-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inJurkat cells, U-937 cells
Positive ChIP-qPCR detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83808-2-RR targets GATA3 in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0174

Product name: Recombinant human GATA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 224-442 aa of BC003070

Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM

Predict reactive species
Full Name GATA binding protein 3
Calculated Molecular Weight 443 aa, 48 kDa
GenBank Accession NumberBC003070
Gene Symbol GATA3
Gene ID (NCBI) 2625
RRIDAB_3671396
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP23771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. This is a rabbit polyclonal antibody raised against part of C-terminus of human GATA3.

Protocols

Product Specific Protocols
FC protocol for GATA3 antibody 83808-2-RRDownload protocol
IF protocol for GATA3 antibody 83808-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...