Tested Applications
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | Jurkat cells, U-937 cells |
| Positive ChIP-qPCR detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83808-2-RR targets GATA3 in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species |
| Full Name | GATA binding protein 3 |
| Calculated Molecular Weight | 443 aa, 48 kDa |
| GenBank Accession Number | BC003070 |
| Gene Symbol | GATA3 |
| Gene ID (NCBI) | 2625 |
| RRID | AB_3671396 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P23771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. This is a rabbit polyclonal antibody raised against part of C-terminus of human GATA3.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GATA3 antibody 83808-2-RR | Download protocol |
| IF protocol for GATA3 antibody 83808-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







