Tested Applications
| Positive WB detected in | rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22843-1-AP targets GATSL2 in WB, ELISA applications and shows reactivity with human, Rat samples.
| Tested Reactivity | human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18791 Product name: Recombinant human GATSL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-257 aa of BC147030 Sequence: HTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFT Predict reactive species |
| Full Name | GATS-like protein 2 |
| Calculated Molecular Weight | 329 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC147030 |
| Gene Symbol | GATSL2 |
| Gene ID (NCBI) | 729438 |
| RRID | AB_3085703 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | A6NHX0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GATSL2,also named CASTOR2, lacks an arginine-binding capacity and is constitutively associated with GATOR2 complex, resulting in persistent mTORC1 inactivation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GATSL2 antibody 22843-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

