GCGR Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GCGR Recombinant monoclonal antibody, PBS Only (84237-5-PBS)

GCGR Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84237-5-PBS Copied!

Clone No. 241501C4

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

241501C4, GGR, GL R, GL-R, glucagon receptor

• 

  WB analysis using 84237-5-RR (same clone as 84237-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84237-5-RR (GCGR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84237-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Recombinant protein using 84237-5-RR (same clone as 84237-5-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 84237-5-RR (GCGR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84237-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 84237-5-RR (same clone as 84237-5-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug GCGR Recombinant monoclonal antibody (84237-5-RR, Clone:241501C4) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 84237-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84237-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84237-5-RR against Human GCGR were performed. The affinity constant is 71.6 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GCGR in ?

Chat with Able

---

Product Information

84237-5-PBS targets GCGR in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24861

  Product name: Recombinant human GCGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-141 aa of BC104854

  Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF

• Full Name: glucagon receptor
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 62-68 kDa
• GenBank Accession Number: BC104854
• Gene Symbol: GCGR
• Gene ID (NCBI): 2642
• RRID: AB_3743535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47871
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM).