GCGR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84237-5-RR (same clone as 84237-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84237-5-RR (GCGR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84237-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84237-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84237-5-RR against Human GCGR were performed. The affinity constant is 71.6 pM.

GCGR Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84237-5-PBS

Clone No.241501C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

glucagon receptor, GL-R, GL R, GGR, 241501C4

---

Product Information

84237-5-PBS targets GCGR in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24861

  Product name: Recombinant human GCGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-141 aa of BC104854

  Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF

• Full Name: glucagon receptor
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 62-68 kDa
• GenBank Accession Number: BC104854
• Gene Symbol: GCGR
• Gene ID (NCBI): 2642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P47871
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM).