GCH1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28501-1-AP (same clone as 28501-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28501-1-AP (GCH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 28501-1-AP (same clone as 28501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 28501-1-AP (same clone as 28501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 28501-1-AP (same clone as 28501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 28501-1-AP (same clone as 28501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28501-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GCH1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28501-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28501-1-PBS targets GCH1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28896

  Product name: Recombinant human GCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC025415

  Sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

• Full Name: GTP cyclohydrolase 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC025415
• Gene Symbol: GCH1
• Gene ID (NCBI): 2643
• RRID: AB_2881157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30793
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.