GCH1 Polyclonal antibody

• 

  WB analysis using 28501-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28501-1-AP (GCH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

GCH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28501-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

DYT14, DYT5, GCH, GCH1, GTP CH 1, GTP CH I, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: rat liver tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 14 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

28501-1-AP targets GCH1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28896

  Product name: Recombinant human GCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC025415

  Sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

• Full Name: GTP cyclohydrolase 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC025415
• Gene Symbol: GCH1
• Gene ID (NCBI): 2643
• RRID: AB_2881157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30793
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Commun Biol; Cholesterol mediated ferroptosis suppression reveals essential roles of Coenzyme Q and squalene; Authors - Qi Sun
human	WB	Free Radic Res; 3,6-Epidioxy-1,10-bisaboladiene induces ferroptosis-like cell death through lipid peroxidation; Authors - Narandulam Usukhbayar
mouse,human	WB	Nat Cell Biol; Gut microbial metabolite facilitates colorectal cancer development via ferroptosis inhibition; Authors - Weiwei Cui
human	WB	Int J Oncol; Long non‑coding RNA lung cancer‑associated transcript 1 regulates ferroptosis via microRNA‑34a‑5p‑mediated GTP cyclohydrolase 1 downregulation in lung cancer cells; Authors - Fumin Tai
human,mouse	WB,IF	Neuron; Spliceosomal GTPase Eftud2 deficiency-triggered ferroptosis leads to Purkinje cell degeneration; Authors - Guochao Yang
	WB	Cell Death Dis; Identification of genes supporting cold resistance of mammalian cells: lessons from a hibernator; Authors - Masamitsu Sone