GCH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GCH1 Polyclonal antibody (28501-1-AP)

• Featured Product
• KD/KO Validated

GCH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28501-1-AP Copied!

Publications (37)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

EC:3.5.4.16, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1, GTP-CH-I

• 

  WB analysis using 28501-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28501-1-AP (GCH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GCH1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: rat liver tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28501-1-AP targets GCH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28896

  Product name: Recombinant human GCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC025415

  Sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

• Full Name: GTP cyclohydrolase 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC025415
• Gene Symbol: GCH1
• Gene ID (NCBI): 2643
• RRID: AB_2881157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30793
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-GCH1 antibody (Cat# 28501-1-AP) has 37 total citations. Citations appear in journals including Nature Immunology, Nature Cell Biology, Nature Communications, Neuron, Molecular Cell, Nature Chemical Biology, Advanced Science, EMBO Journal, Cell Death & Differentiation, Nature Cancer, ACS Chemical Biology, and Cell Reports. Research fields are predominantly centered on ferroptosis mechanisms, cancer biology (hepatocellular, colorectal, cervical, lung, gastric, ovarian, esophageal, and pancreatic cancers), neurodegeneration, and lipid metabolism.

Automatically generated from the 37 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; Purine salvage pathway protects CD8(+) T cells from metabolic stress.; Authors - Masaki Tajima
mouse,human	WB	Nat Cell Biol; Gut microbial metabolite facilitates colorectal cancer development via ferroptosis inhibition; Authors - Weiwei Cui
		Nat Cell Biol; Stress granules restrain ferroptosis by sequestering ferritin; Authors - Zehe Ge
human	WB	Nat Commun; S100P is a ferroptosis suppressor to facilitate hepatocellular carcinoma development by rewiring lipid metabolism; Authors - Min Yang
human	WB	Nat Commun; TET1 as a master regulator controlling GPX4-dependent and -independent ferroptosis surveillance in acute myeloid leukemia.; Authors - Lingling Yang
mouse,human	WB,IF	Neuron; Spliceosomal GTPase Eftud2 deficiency-triggered ferroptosis leads to Purkinje cell degeneration; Authors - Guochao Yang