GCH1 Polyclonal antibody

• 

  WB analysis using 28501-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28501-1-AP (GCH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 28501-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28501-1-AP (GCH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

GCH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28501-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

EC:3.5.4.16, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1, GTP-CH-I

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: rat liver tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 14 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

28501-1-AP targets GCH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28896

  Product name: Recombinant human GCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC025415

  Sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

• Full Name: GTP cyclohydrolase 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC025415
• Gene Symbol: GCH1
• Gene ID (NCBI): 2643
• RRID: AB_2881157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30793
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Cell Biol; Gut microbial metabolite facilitates colorectal cancer development via ferroptosis inhibition; Authors - Weiwei Cui
		Commun Biol; Cholesterol mediated ferroptosis suppression reveals essential roles of Coenzyme Q and squalene; Authors - Qi Sun
human	WB	Free Radic Res; 3,6-Epidioxy-1,10-bisaboladiene induces ferroptosis-like cell death through lipid peroxidation; Authors - Narandulam Usukhbayar
human	WB	Nat Commun; S100P is a ferroptosis suppressor to facilitate hepatocellular carcinoma development by rewiring lipid metabolism; Authors - Min Yang
human	WB	Mol Med; Upregulation of PRRX2 by silencing Marveld3 as a protective mechanism against radiation-induced ferroptosis in skin cells; Authors - Jinming Cao
human	WB	iScience; GPX4-dependent ferroptosis sensitivity is a fitness trade-off for cell enlargement; Authors - Kuan Yoow Chan