GCS1 Polyclonal antibody, PBS Only

• 

  WB analysis using 17859-1-AP (same clone as 17859-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 17859-1-AP (GCS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 17859-1-AP (same clone as 17859-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17859-1-AP (GCS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17859-1-AP (same clone as 17859-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17859-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GCS1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17859-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17859-1-PBS targets GCS1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12321

  Product name: Recombinant human MOGS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 492-837 aa of BC028337

  Sequence: DEARARVPPEFLVQRAVHANPPTLLLPVAHMLEVGDPDDLAFLRKALPRLHAWFSWLHQSQAGPLPLSYRWRGRDPALPTLLNPKTLPSGLDDYPRASHPSVTERHLDLRCWVALGARVLTRLAEHLGEAEVAAELGPLAASLEAAESLDELHWAPELGVFADFGNHTKAVQLKPRPPQGLVRVVGRPQPQLQYVDALGYVSLFPLLLRLLDPTSSRLGPLLDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALGALHHYGHLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLVLLAMAEDY

• Full Name: mannosyl-oligosaccharide glucosidase
• Calculated Molecular Weight: 837 aa, 92 kDa
• Observed Molecular Weight: 80-92 kDa
• GenBank Accession Number: BC028337
• Gene Symbol: GCS1
• Gene ID (NCBI): 7841
• RRID: AB_10694270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13724
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MOGS (Mannosyl-oligosaccharide glucosidase), also known as GCS1, is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor (PMID: 38187061). The resulting Glc(2)-Man(9)-GlcNAc(2) intermediate is then further modified by glucosidase II and several ER- and Golgi-resident mannosidases and glycosyltransferases, finally yielding a complex array of glycan structures (PMID: 3896128). MOGS has two isoforms, and it is located in the lumen of the endoplasmic reticulum.