SLC25A16 Monoclonal antibody

• 

  WB analysis using 68107-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68107-1-Ig (GDA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

SLC25A16 Monoclonal Antibody for WB, ELISA

Cat No. 68107-1-Ig

Clone No.3F10C8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

Synonyms

hGP, Graves' didease protein, GDC, D10S105E, 3F10C8

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68107-1-Ig targets SLC25A16 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4891

  Product name: Recombinant human GDA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-332 aa of BC030266

  Sequence: MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN

• Full Name: solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC030266
• Gene Symbol: GDA
• Gene ID (NCBI): 8034
• RRID: AB_2923636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16260
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDA, also named as SLC25A16, GDC, ML7, hML7, belongs to the mitochondrial carrier family. GDA encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the mitochondrion inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has been associated with Graves' disease (PMID:11158296, 1457817).