Tested Applications
| Positive WB detected in | fetal human brain tissue, A2780 cells, SKOV-3 cells, mouse ovary tissue, rat ovary tissue, mouse brain tissue, mouse testis tissue, rat brain tissue, rat testis tissue |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
29309-1-AP targets GDF9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29603 Product name: Recombinant human GDF9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-454 aa of BC096228 Sequence: TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR Predict reactive species |
| Full Name | growth differentiation factor 9 |
| Calculated Molecular Weight | 454 aa, 51 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC096228 |
| Gene Symbol | GDF9 |
| Gene ID (NCBI) | 2661 |
| RRID | AB_3086112 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60383 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GDF9 (Growth/differentiation factor 9) belongs to the TGF-beta family. GDF9 is required for ovarian folliculogenesis. GDF9 and BMP15 are oocyte-secreted factors with a leading role in the control of ovarian function in female reproduction, modulating both the cell fate of the somatic granulosa cells and the quality and developmental competence of the egg (PMID: 29544636). GDF9 promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation (PMID: 19366876). It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. GDF9 attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B (PMID: 21829661). It suppresses FST and FSTL3 production in granulosa-lutein cells (PMID: 21632818, PMID: 21829661).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GDF9 antibody 29309-1-AP | Download protocol |
| IHC protocol for GDF9 antibody 29309-1-AP | Download protocol |
| WB protocol for GDF9 antibody 29309-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Apoptosis CCDC134 enhances ovarian reserve function and angiogenesis by directly interacting with INHA in a mouse model of premature ovarian insufficiency | ||
Oncogene HDAC1/2-mediated deacetylation of KLF9 promotes the malignant progression of nasopharyngeal carcinoma via CDH17 | ||
J Pharmacol Sci Specnuezhenide and ecliptasaponin A from Ligustrum lucidum Ait and Ecliptae Herba improved premature ovarian failure by targeting the ESR1 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH MALLIKARJUNA (Verified Customer) (10-24-2025) | best for western blot
|
FH Yiran (Verified Customer) (09-19-2024) | Works well on paraffin-fixed sheep ovary for immunofluorescent
![]() |








