Tested Applications
| Positive WB detected in | mouse liver tissue, A431 cells, A375 cells, rat liver tissue, HepG2 cells | 
| Positive IP detected in | mouse liver tissue | 
| Positive IHC detected in | human liver cancer tissue, human liver tissue,  human testis tissue,  human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | mouse kidney tissue | 
| Positive FC (Intra) detected in | A431 cells, HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below | 
| WB | See 25 publications below | 
| IHC | See 3 publications below | 
| IF | See 9 publications below | 
| IP | See 1 publications below | 
Product Information
11293-1-AP targets ALR in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1840 Product name: Recombinant human GFER protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC028348 Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD Predict reactive species | 
                                    
| Full Name | growth factor, augmenter of liver regeneration | 
| Calculated Molecular Weight | 15 kDa, 23 kDa | 
| Observed Molecular Weight | 23-25 kDa | 
| GenBank Accession Number | BC028348 | 
| Gene Symbol | GFER | 
| Gene ID (NCBI) | 2671 | 
| RRID | AB_2109970 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P55789 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
GFER (FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria. The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23/21 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus (PMID: 19409522, 24880092, 21152698).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALR antibody 11293-1-AP | Download protocol | 
| IHC protocol for ALR antibody 11293-1-AP | Download protocol | 
| IP protocol for ALR antibody 11293-1-AP | Download protocol | 
| WB protocol for ALR antibody 11293-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.
  | ||
Hepatology Hepatic stimulator substance resists hepatic ischemia/reperfusion injury by regulating Drp1 translocation and activation.
  | ||
Am J Hum Genet The mitochondrial disulfide relay system protein GFER is mutated in autosomal-recessive myopathy with cataract and combined respiratory-chain deficiency. | ||
Elife Augmenter of liver regeneration regulates cellular iron homeostasis by modulating mitochondrial transport of ATP-binding cassette B8.
  | ||
FASEB J Augmenter of liver regeneration protein deficiency promotes hepatic steatosis by inducing oxidative stress and microRNA-540 expression.
  | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Yaschar (Verified Customer) (06-26-2018)  | sample: 20 µg highly purified rat liver mitochondriaVery poor signal intensity even after 30(!) mintues of exposure (see image). Note that this is the best signal I was able to get.Barely any signal in different whole cell lysate.Even after changing the PAGE and Blotting protocols the signal does not get better, incubating over night does not help either.High number of unspecified bands, different lysate and reduction protocols did not help in this regard.I am extremely unsatisfied with this antibody. 
 ![]()  | 




































