• Featured Product
  • KD/KO Validated

ALR Polyclonal antibody

ALR Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 11293-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

GFER, HERV1, Hepatopoietin, FAD-linked sulfhydryl oxidase ALR, ERV1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, A431 cells, A375 cells, rat liver tissue, HepG2 cells
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver cancer tissue, human liver tissue, human testis tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11293-1-AP targets ALR in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1840

Product name: Recombinant human GFER protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-125 aa of BC028348

Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Predict reactive species
Full Name growth factor, augmenter of liver regeneration
Calculated Molecular Weight 15 kDa, 23 kDa
Observed Molecular Weight 23-25 kDa
GenBank Accession NumberBC028348
Gene Symbol GFER
Gene ID (NCBI) 2671
RRIDAB_2109970
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55789
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFER (FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria. The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23/21 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus (PMID: 19409522, 24880092, 21152698).

Protocols

Product Specific Protocols
WB protocol for ALR antibody 11293-1-APDownload protocol
IHC protocol for ALR antibody 11293-1-APDownload protocol
IF protocol for ALR antibody 11293-1-APDownload protocol
IP protocol for ALR antibody 11293-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Stem Cell

Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.

Authors - Rashim Pal Singh
  • KD Validated
human,mouseWB

Hepatology

Hepatic stimulator substance resists hepatic ischemia/reperfusion injury by regulating Drp1 translocation and activation.

Authors - Chao Zhang
  • KD Validated
humanWB,IF

Am J Hum Genet

The mitochondrial disulfide relay system protein GFER is mutated in autosomal-recessive myopathy with cataract and combined respiratory-chain deficiency.

Authors - Di Fonzo Alessio A
humanWB,IF

Aging Cell

Dependence of PINK1 accumulation on mitochondrial redox system.

Authors - Feng Gao
mouseWB

Elife

Augmenter of liver regeneration regulates cellular iron homeostasis by modulating mitochondrial transport of ATP-binding cassette B8.

Authors - Hsiang-Chun Chang
  • KD Validated
mouseWB,IF

FASEB J

Augmenter of liver regeneration protein deficiency promotes hepatic steatosis by inducing oxidative stress and microRNA-540 expression.

Authors - Sudhir Kumar
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Yaschar (Verified Customer) (06-26-2018)

sample: 20 µg highly purified rat liver mitochondriaVery poor signal intensity even after 30(!) mintues of exposure (see image). Note that this is the best signal I was able to get.Barely any signal in different whole cell lysate.Even after changing the PAGE and Blotting protocols the signal does not get better, incubating over night does not help either.High number of unspecified bands, different lysate and reduction protocols did not help in this regard.I am extremely unsatisfied with this antibody.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Isolated rat liver mitochondria (high purity)
ALR Antibody Western Blot, validation (1:1000 dilution) in Isolated rat liver mitochondria (high purity) (Cat no:11293-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...