GHITM Polyclonal antibody

• 

  WB analysis of mouse liver using 16296-1-AP

  mouse liver mitochondria tissue were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16296-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16296-1-AP

  WB results of GHITM antibody (16296-1-AP) with siRNA sample.

• 

  WB analysis of HeLa using 16296-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 16296-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 16296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16296-1-AP (GHITM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16296-1-AP (GHITM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 16296-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GHITM antibody (16296-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

GHITM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16296-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Dermal papilla-derived protein 2, DERP2, Growth hormone-inducible transmembrane protein, MICS1, My021

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HEK-293 cells, HeLa cells, SH-SY5Y cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below

Product Information

16296-1-AP targets GHITM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9482

  Product name: Recombinant human GHITM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC010354

  Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME

• Full Name: growth hormone inducible transmembrane protein
• Calculated Molecular Weight: 345 aa, 37 kDa
• Observed Molecular Weight: 42 kDa, 25-27 kDa
• GenBank Accession Number: BC010354
• Gene Symbol: GHITM
• Gene ID (NCBI): 27069
• RRID: AB_2111275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3K2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein which localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. The apparent molecular weight has been reported to be 42 kDa, the increased size in the protein may be due to post-translational modifications (PMID: 11416014; 16412389). GHITM can be cleaved into smaller forms of 23-27 kDa (PMID: 16412389; 18417609).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Early macrophage response to obesity encompasses Interferon Regulatory Factor 5 regulated mitochondrial architecture remodelling; Authors - L. Orliaguet
	WB	Aging Cell; Chaperone-mediated autophagy degrades Keap1 and promotes Nrf2-mediated antioxidative response.; Authors - Lin Zhu
human	WB	EMBO J; Regulation of mitochondrial proteostasis by the proton gradient; Authors - Maria Patron
human	WB	Cells; Transmembrane BAX Inhibitor-1 Motif Containing Protein 5 (TMBIM5) Sustains Mitochondrial Structure, Shape, and Function by Impacting the Mitochondrial Protein Synthesis Machinery.; Authors - Bruno Seitaj ; KO Validated
human	WB	Biochim Biophys Acta Mol Cell Res; Impact of PARL-mediated mitochondrial protease activity on calcium regulation; Authors - Donato D'Angelo
human	WB	Life Sci Alliance; TMBIM5 loss of function alters mitochondrial matrix ion homeostasis and causes a skeletal myopathy.; Authors - Li Zhang