GINS1 Polyclonal antibody, PBS Only

• 

  WB analysis using 16061-1-AP (same clone as 16061-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16061-1-AP (GINS1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16061-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16061-1-AP (same clone as 16061-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16061-1-AP (GINS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16061-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 16061-1-AP (same clone as 16061-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16061-1-AP (GINS1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16061-1-PBS in a different storage buffer formulation.

GINS1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16061-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PSF1, KIAA0186, GINS complex subunit 1

---

Product Information

16061-1-PBS targets GINS1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8895

  Product name: Recombinant human GINS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC012542

  Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

• Full Name: GINS complex subunit 1 (Psf1 homolog)
• Calculated Molecular Weight: 196 aa, 23 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC012542
• Gene Symbol: GINS1
• Gene ID (NCBI): 9837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14691
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GINS1, also known as Partner of SLD Five 1 (PSF1) is a member of the GINS (Go-Ichi-Nii-San) complex, which plays a vital role in the initiation and elongation of DNA replication (PMID: 34414190). GINS1 was initially found to be predominantly expressed in highly proliferating cells instead of mature cells. Later on, it was found that GINS was involved in the tumorigenesis of various cancers, including breast cancer, colorectal cancer, and hepatocellular carcinoma (PMID: 36065190).