Tested Applications
Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18230-1-AP targets GIPR in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12842 Product name: Recombinant human GIPR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-142 aa of BC093723 Sequence: TGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYT Predict reactive species |
Full Name | gastric inhibitory polypeptide receptor |
Calculated Molecular Weight | 466 aa, 53 kDa |
GenBank Accession Number | BC093723 |
Gene Symbol | GIPR |
Gene ID (NCBI) | 2696 |
RRID | AB_2878521 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48546 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GIPR antibody 18230-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |