GK2 Polyclonal antibody, PBS Only

• 

  WB analysis using 12913-1-AP (same clone as 12913-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12913-1-AP (GK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12913-1-PBS in a different storage buffer formulation.

GK2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12913-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12913-1-PBS targets GK2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4010

  Product name: Recombinant human GK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-324 aa of BC029820

  Sequence: NSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAYYALEGSVAI

• Full Name: glycerol kinase 2
• Calculated Molecular Weight: 553 aa, 61 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC029820
• Gene Symbol: GK2
• Gene ID (NCBI): 2712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14410
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GK2 (glycerol kinase 2) is a key enzyme in the regulation of glycerol uptake and metabolism.