GLI4 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 16551-1-AP (same clone as 16551-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16551-1-AP (GLI4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16551-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16551-1-AP (same clone as 16551-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16551-1-AP (GLI4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16551-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 16551-1-AP (same clone as 16551-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using GLI4 antibody (16551-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16551-1-PBS in a different storage buffer formulation.

GLI4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16551-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16551-1-PBS targets GLI4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9497

  Product name: Recombinant human GLI4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC014165

  Sequence: MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE

• Full Name: GLI family zinc finger 4
• Calculated Molecular Weight: 376 aa, 41 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC014165
• Gene Symbol: GLI4
• Gene ID (NCBI): 2738
• RRID: AB_2109716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10075
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.