GLI4 Polyclonal antibody

• 

  WB analysis of Jurkat using 16551-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16551-1-AP (GLI4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16551-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16551-1-AP (GLI4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 16551-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using GLI4 antibody (16551-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

GLI4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16551-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Zinc finger protein GLI4, Protein HKR4, Krueppel-related zinc finger protein 4, HKR4, GLI family zinc finger 4

---

Tested Applications

• Positive WB detected in: Jurkat cells, PC-3 cells, SH-SY5Y cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16551-1-AP targets GLI4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9497

  Product name: Recombinant human GLI4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC014165

  Sequence: MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE

• Full Name: GLI family zinc finger 4
• Calculated Molecular Weight: 376 aa, 41 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC014165
• Gene Symbol: GLI4
• Gene ID (NCBI): 2738
• RRID: AB_2109716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

iru (Verified Customer) (12-14-2020)

It works at 1:500 O/N incubation.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Fallopian tube epithelial cells