Use Able AI chat for product recommendations

GLIS3 Polyclonal antibody, PBS Only

GLIS3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12678-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12678-1-PBS targets GLIS3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3366

Product name: Recombinant human GLIS3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 429-775 aa of BC033899

Sequence: LKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG

Predict reactive species
Full Name GLIS family zinc finger 3
Calculated Molecular Weight 775 aa, 84 kDa
Observed Molecular Weight 70-85 kDa
GenBank Accession NumberBC033899
Gene Symbol GLIS3
Gene ID (NCBI) 169792
RRIDAB_2877873
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NEA6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. GLIS3 (gLIS family zinc finger 3), also known as ZNF515 that localizes to the nucleus and contains five C2H2-type zinc fingers. Expressed in a variety of tissues, including kidney, brain, liver, lung, ovary, pancreas, thymus and skeletal muscle, GLIS3 functions as both an activator and a suppressor of transcription, specifically binding the consensus sequence 5'-GACCACCCAC-3' through its C2H2-type zinc fingers. Defects in the gene encoding GLIS3 are a cause of NDH syndrome; a neonatal diabetes that is characterized by congenital hypothyroidism, congenital glaucoma, hepatic fibrosis and polycystic kidneys. There are various isoform of GLIS3 and molecular weight of one isoform is 70 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...