Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20171-1-AP targets GLS2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14003 Product name: Recombinant human GLS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC059370 Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ Predict reactive species |
| Full Name | glutaminase 2 (liver, mitochondrial) |
| Calculated Molecular Weight | 602 aa, 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC059370 |
| Gene Symbol | GLS2 |
| Gene ID (NCBI) | 27165 |
| RRID | AB_3085600 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UI32 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GLS2 antibody 20171-1-AP | Download protocol |
| IHC protocol for GLS2 antibody 20171-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





