Rat GM-CSF Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293T using 86923-1-RR (same clone as 86923-1-PBS)

  Non-transfected and rat GM-CS Transfected HEK-293T cells were subjected to SDS PAGE followed by western blot with 86923-1-RR (GM-CSF/CSF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86923-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86923-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86923-1-RR against Rat GM-CSF were performed. The affinity constant is 35.8 pM.

GM-CSF Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86923-1-PBS

Clone No.243117B1

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, Indirect ELISA

Synonyms

Colony-stimulating factor, CSF, Csf2, Csfgm, Granulocyte-macrophage colony-stimulating factor

---

Product Information

86923-1-PBS targets GM-CSF in WB, Indirect ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3202

  Product name: Recombinant Rat GM-CSF protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 18-144 aa of NM_053852.1

  Sequence: APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

• Full Name: colony stimulating factor 2 (granulocyte-macrophage)
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: NM_053852.1
• Gene Symbol: Csf2
• Gene ID (NCBI): 116630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48750
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gm-csf, also known as Csf2, is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts that functions as a cytokine. Gm-csf was first characterized as a hematopoietic growth factor that stimulates the proliferation of myeloid cells from bone-marrow progenitors. Gm-csf is now recognized as an important activating and differentiation factor for immune cells, and is essential for a wide range of biological processes in both innate and adaptive immunity. Gm-csf has been shown to protect against pulmonary infection and intestinal inflammation, and it is necessary for normal pulmonary and colon homeostasis.