GMAP-210 Polyclonal antibody

• 

  WB analysis of HeLa using 26456-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26456-1-AP (GMAP-210 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 26456-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26456-1-AP (GMAP-210 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 26456-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26456-1-AP (GMAP-210 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 26456-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26456-1-AP (GMAP-210 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 26456-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26456-1-AP (GMAP-210 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 26456-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 26456-1-AP (GMAP-210 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 26456-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GMAP-210 antibody (26456-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

GMAP-210 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26456-1-AP

Publications(5)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TRIP11, TR-interacting protein 11, Thyroid receptor-interacting protein 11, Golgi-associated microtubule-binding protein 210, GMAP 210

---

Tested Applications

• Positive WB detected in: HeLa cells, HL-60 cells
• Positive IHC detected in: human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 2 publications below

Product Information

26456-1-AP targets GMAP-210 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13867

  Product name: Recombinant human GMAP-210 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC002656

  Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE

• Full Name: thyroid hormone receptor interactor 11
• Calculated Molecular Weight: 1979 aa, 228 kDa
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: BC002656
• Gene Symbol: TRIP11
• Gene ID (NCBI): 9321
• RRID: AB_2880519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Biol Chem; Tumor protein D54 binds intracellular nanovesicles via an extended amphipathic region.; Authors - Antoine Reynaud
human	WB	Commun Biol; Tankyrase-1-mediated degradation of Golgin45 regulates glycosyltransferase trafficking and protein glycosylation in Rab2-GTP-dependent manner.; Authors - Xihua Yue
human	WB,IF	Hum Mutat; Biallelic deep intronic variant c.5457+81T>A in TRIP11 causes loss of function and results in achondrogenesis 1A.; Authors - Priyanka Upadhyai
human	WB	Biol Open; GRASP55 restricts early-stage autophagy and regulates spatial organization of the early secretory network.; Authors - Jennifer Y Liu ; KD Validated
		Nat Commun; Dynamic movement of the Golgi unit and its glycosylation enzyme zones; Authors - Akihiro Harada

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (04-28-2023)

clean band around the expected size

• Applications: Western Blot

FH

Yuki (Verified Customer) (01-24-2023)

I will recommend this antibody for IF

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: 293T

GMAP-210 Antibody Immunofluorescence validation (1:250 dilution) in 293T (Cat no:26456-1-AP)