Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GMAP-210 Polyclonal antibody

GMAP-210 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26456-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

TRIP11, TR-interacting protein 11, Thyroid receptor-interacting protein 11, Golgi-associated microtubule-binding protein 210, GMAP 210

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HL-60 cells
Positive IHC detected inhuman thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26456-1-AP targets GMAP-210 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13867

Product name: Recombinant human GMAP-210 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-68 aa of BC002656

Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE

Predict reactive species
Full Name thyroid hormone receptor interactor 11
Calculated Molecular Weight 1979 aa, 228 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC002656
Gene Symbol TRIP11
Gene ID (NCBI) 9321
RRIDAB_2880519
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15643
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.

Protocols

Product Specific Protocols
IF protocol for GMAP-210 antibody 26456-1-APDownload protocol
IHC protocol for GMAP-210 antibody 26456-1-APDownload protocol
WB protocol for GMAP-210 antibody 26456-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

J Biol Chem

Tumor protein D54 binds intracellular nanovesicles via an extended amphipathic region.

Authors - Antoine Reynaud
humanWB

Commun Biol

Tankyrase-1-mediated degradation of Golgin45 regulates glycosyltransferase trafficking and protein glycosylation in Rab2-GTP-dependent manner.

Authors - Xihua Yue
humanWB,IF

Hum Mutat

Biallelic deep intronic variant c.5457+81T>A in TRIP11 causes loss of function and results in achondrogenesis 1A.

Authors - Priyanka Upadhyai
humanWB

Biol Open

GRASP55 restricts early-stage autophagy and regulates spatial organization of the early secretory network.

Authors - Jennifer Y Liu
  • KD Validated

Nat Commun

Dynamic movement of the Golgi unit and its glycosylation enzyme zones

Authors - Akihiro Harada
mouseWB

Ecotoxicol Environ Saf

PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice.

Authors - Chuan Wang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Boyan (Verified Customer) (04-28-2023)

clean band around the expected size

  • Applications: Western Blot

Yuki (Verified Customer) (01-24-2023)

I will recommend this antibody for IF

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: 293T
GMAP-210 Antibody Immunofluorescence validation (1:250 dilution) in 293T (Cat no:26456-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...