• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GMAP-210 Polyclonal antibody

GMAP-210 Polyclonal Antibody for IF/ICC
Cat No. CL488-26456

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CEV14, GMAP 210, GMAP-210, TR interacting protein 11, TRIP 11, TRIP11, TRIP230

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26456 targets GMAP-210 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13867

Product name: Recombinant human GMAP-210 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-68 aa of BC002656

Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE

Predict reactive species
Full Name thyroid hormone receptor interactor 11
Calculated Molecular Weight 1979 aa, 228 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC002656
Gene Symbol TRIP11
Gene ID (NCBI) 9321
RRIDAB_3672798
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15643
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GMAP-210 antibody CL488-26456Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...