Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-26456 targets GMAP-210 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13867 Product name: Recombinant human GMAP-210 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002656 Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE Predict reactive species |
| Full Name | thyroid hormone receptor interactor 11 |
| Calculated Molecular Weight | 1979 aa, 228 kDa |
| Observed Molecular Weight | 230 kDa |
| GenBank Accession Number | BC002656 |
| Gene Symbol | TRIP11 |
| Gene ID (NCBI) | 9321 |
| RRID | AB_3672798 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15643 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 GMAP-210 antibody CL488-26456 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

