CoraLite® Plus 488-conjugated GMAP-210 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-26456

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 GMAP-210 antibody (CL488-26456) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

GMAP-210 Polyclonal Antibody for IF/ICC

Cat No. CL488-26456

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CEV14, GMAP 210, GMAP-210, TR interacting protein 11, TRIP 11, TRIP11, TRIP230

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26456 targets GMAP-210 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13867

  Product name: Recombinant human GMAP-210 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC002656

  Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE

• Full Name: thyroid hormone receptor interactor 11
• Calculated Molecular Weight: 1979 aa, 228 kDa
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: BC002656
• Gene Symbol: TRIP11
• Gene ID (NCBI): 9321
• RRID: AB_3672798
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15643
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus.