GMFG Polyclonal antibody, PBS Only

• 

  WB analysis of rat brain using 13625-1-AP (same clone as 13625-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 13625-1-AP (GMFG Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 13625-1-AP (same clone as 13625-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13625-1-AP (GMFG Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse placenta using 13625-1-AP (same clone as 13625-1-PBS)

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 13625-1-AP (GMFG Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 13625-1-AP (same clone as 13625-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 13625-1-AP (GMFG antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse spleen using 13625-1-AP (same clone as 13625-1-PBS)

  IP result of anti-GMFG (IP:13625-1-AP, 4ug; Detection:13625-1-AP 1:600) with mouse spleen tissue lysate 2000 ug. This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13625-1-AP (GMFG antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13625-1-AP (GMFG antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 13625-1-AP (GMFG antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13625-1-AP (GMFG Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13625-1-AP (same clone as 13625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13625-1-AP (GMFG Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13625-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GMFG Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13625-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Glia maturation factor gamma, glia maturation factor, gamma, GMF GAMMA, GMF-gamma

---

Product Information

13625-1-PBS targets GMFG in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4538

  Product name: Recombinant human GMFG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC032819

  Sequence: SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

• Full Name: glia maturation factor, gamma
• Calculated Molecular Weight: 141 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC032819
• Gene Symbol: GMFG
• Gene ID (NCBI): 9535
• RRID: AB_2110929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60234
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GMFG, is a highly conserved brain-specific protein that belongs to the GMF subfamily of the larger Actin-binding protein ADF family. GMFG is preferentially expressed in blood vessel cells and immune cells and its ectopic expression enhances cellular functions such as tube-formation and migration in vitro. GMFG mediates neutrophil and T-lymphocyte migration via regulation of actin cytoskeletal reorganization. GMFG also acts as an intracellular regulator of stress-activated signal transduction by demonstrating activation of p38 MAP kinase and transcription factor NF-kB in astrocytes.