Geminin Monoclonal antibody, PBS Only (Capture)

Geminin Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66566-1-PBS
Clone No.2E3A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

GMNN, 2E3A2, Gem, MGORS6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66566-1-PBS targets Geminin as part of a matched antibody pair:

MP51458-1: 66566-1-PBS capture and 66566-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24283

Product name: Recombinant human GMNN protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-209 aa of BC005185

Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

Predict reactive species
Full Name geminin, DNA replication inhibitor
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC005185
Gene Symbol GMNN
Gene ID (NCBI) 51053
RRIDAB_2881927
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75496
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623)

Loading...
||
New chat Able
正在加载,请稍候...