Geminin Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66566-1-Ig (same clone as 66566-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66566-1-Ig (same clone as 66566-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66566-1-Ig (same clone as 66566-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66566-1-Ig (same clone as 66566-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66566-1-Ig (same clone as 66566-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66566-1-Ig (same clone as 66566-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66566-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51458-1

  Cytometric bead array sample test of MP51458-1, GMNN Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66566-1-PBS. Detection antibody: 66566-2-PBS.

• 

  Cytometric bead array standard curve of MP51458-1

  Cytometric bead array standard curve of MP51458-1, GMNN Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66566-1-PBS. Detection antibody: 66566-2-PBS. Standard:Ag24283. Range: 1.563-200 ng/mL.

Geminin Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 66566-1-PBS

Clone No.2E3A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

GMNN, 2E3A2, Gem, MGORS6

---

Product Information

66566-1-PBS targets Geminin as part of a matched antibody pair:

MP51458-1: 66566-1-PBS capture and 66566-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24283

  Product name: Recombinant human GMNN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-209 aa of BC005185

  Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

• Full Name: geminin, DNA replication inhibitor
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC005185
• Gene Symbol: GMNN
• Gene ID (NCBI): 51053
• RRID: AB_2881927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75496
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623)