Geminin Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Geminin Monoclonal antibody (66566-1-Ig)

Geminin Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66566-1-Ig Copied!

Clone No. 2E3A2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, ELISA
For IF, select conjugated version.

Synonyms

GMNN, 2E3A2, Gem, MGORS6

• 

  WB analysis using 66566-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66566-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Geminin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, HEK-293 cells, NCCIT cells, Jurkat cells
• Positive IHC detected in: human colon cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66566-1-Ig targets Geminin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24283

  Product name: Recombinant human GMNN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-209 aa of BC005185

  Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

• Full Name: geminin, DNA replication inhibitor
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC005185
• Gene Symbol: GMNN
• Gene ID (NCBI): 51053
• RRID: AB_2881927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75496
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623)

Publications

What published studies show

The Geminin Monoclonal antibody (2E3A2), catalog number 66566-1-Ig, has 1 total citation. The cited publication appeared in Cell Reports (2023) and investigated the role of FMRP degradation in neuronal hyperexcitability within tuberous sclerosis complex. The research field is neuroscience, specifically related to neurodevelopmental disorders and cell cycle regulation in neurons. The antibody was used for Western blotting in rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Cell Rep; Increased degradation of FMRP contributes to neuronal hyperexcitability in tuberous sclerosis complex; Authors - Kellen D Winden