Geminin Monoclonal antibody

• 

  WB analysis using 66566-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66566-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66566-1-Ig (GMNN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66566-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66566-1-Ig (GMNN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Geminin Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66566-1-Ig

Clone No.2E3A2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

GMNN, MGORS6, Gem, 2E3A2

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, HEK-293 cells, NCCIT cells, Jurkat cells
• Positive IHC detected in: human colon cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66566-1-Ig targets Geminin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24283

  Product name: Recombinant human GMNN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-209 aa of BC005185

  Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

• Full Name: geminin, DNA replication inhibitor
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC005185
• Gene Symbol: GMNN
• Gene ID (NCBI): 51053
• RRID: AB_2881927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75496
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Cell Rep; Increased degradation of FMRP contributes to neuronal hyperexcitability in tuberous sclerosis complex; Authors - Kellen D Winden