GNA12 Polyclonal antibody

• 

  WB analysis using 31431-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31431-1-AP (GNA12 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 31431-1-AP

  WB result of GNA12 antibody (31431-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-GNA12 transfected HepG2 cells.

• Featured Product
• KD/KO Validated

GNA12 Polyclonal Antibody for WB, ELISA

Cat No. 31431-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

G alpha 12, G alpha-12, G protein subunit alpha 12, gep, GNA 12

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31431-1-AP targets GNA12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35068

  Product name: Recombinant human GNA12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-172 aa of BC087537

  Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE

• Full Name: guanine nucleotide binding protein (G protein) alpha 12
• Observed Molecular Weight: 37-39 kDa
• GenBank Accession Number: BC087537
• Gene Symbol: GNA12
• Gene ID (NCBI): 2768
• RRID: AB_3669980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q03113
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein subunit alpha 12 (GNA12) is a member of the G12 family of G protein alpha subunits. It has 3 isoforms and is expressed in many tissues including lung, testis and placenta. GNA12/13-mediated signaling pathways are involved in a variety of physiological processes including cell growth, cell migration, angiogenesis, platelet activation and apoptosis (PMID: 37426201).