Tested Applications
Positive WB detected in | Jurkat cells, HeLa cells, rat brain tissue, pig cerebellum tissue, rat cerebellum tissue, MCF-7 cells, pig brain tissue, rabbit brain tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
68191-1-Ig targets GNAQ in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Reactivity | human, mouse, rat, pig, rabbit |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26178 Product name: Recombinant human GNAQ protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 84-205 aa of BC057777 Sequence: FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD Predict reactive species |
Full Name | guanine nucleotide binding protein (G protein), q polypeptide |
Calculated Molecular Weight | 42 kDa |
Observed Molecular Weight | 38-40 kDa |
GenBank Accession Number | BC057777 |
Gene Symbol | GNAQ |
Gene ID (NCBI) | 2776 |
RRID | AB_2935280 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P50148 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GNAQ is a proto-oncogene closely related to the α subunit of guanine nucleotide-binding proteins (G proteins) that serve as key intermediates between membrane-bound G-protein-coupled receptors (GPCRs) and GPCR signalling nodes. Aberrant expression and activity of G proteins and GPCRs are frequently associated with tumorigenesis. Recent studies show that oncogenic activating mutations in GNAQ are present in 80% of the melanomas. The calculated molecular weight of GNAQ is 42 kDa. This antibody can detect a band of 38-40 kDa in SDS-PAGE. (PMID: 33993733)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GNAQ antibody 68191-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (12-29-2023) | Worked well for WB at 1:1000 in Glioma cells
|