GNB3 Polyclonal antibody, PBS Only

• 

  WB analysis using 10081-1-AP (same clone as 10081-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10081-1-AP (same clone as 10081-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse embryo using 10081-1-AP (same clone as 10081-1-PBS)

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10081-1-AP (same clone as 10081-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10081-1-AP (same clone as 10081-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10081-1-AP (same clone as 10081-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GNB3 antibody (10081-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 10081-1-PBS in a different storage buffer formulation.

GNB3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10081-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

---

Product Information

10081-1-PBS targets GNB3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0127

  Product name: Recombinant human GNB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC000115

  Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC000115
• Gene Symbol: GNB3
• Gene ID (NCBI): 2784
• RRID: AB_2263264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.