GNB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNB3 Polyclonal antibody (10081-1-AP)

GNB3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10081-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

• 

  WB analysis using 10081-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10081-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse embryo using 10081-1-AP

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10081-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10081-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10081-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GNB3 antibody (10081-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse embryo tissue, rat brain tissue, mouse cerebellum tissue, mouse eye tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10081-1-AP targets GNB3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0127

  Product name: Recombinant human GNB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC000115

  Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC000115
• Gene Symbol: GNB3
• Gene ID (NCBI): 2784
• RRID: AB_2263264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Publications

What published studies show

GNB3 Polyclonal antibody (Cat# 10081-1-AP) has 10 citations published in Nature Communications, Neuron, Acta Neuropathologica Communications, Scientific Reports, FASEB Journal, Journal of Biological Chemistry, Human Molecular Genetics, Discovery Oncology, eLife, and Virchows Arch. Research fields span immunology, neuroscience, cardiovascular biology, ophthalmology, oncology, pulmonary biology, and pathology.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; The immune landscape of human thymic epithelial tumors; Authors - Zhongwei Xin
human	WB	Neuron; Sustained antidepressant effects of ketamine metabolite involve GABAergic inhibition-mediated molecular dynamics in aPVT glutamatergic neurons; Authors - Ayako Kawatake-Kuno
human	WB	Acta Neuropathol Commun; Synaptic proteomics reveal distinct molecular signatures of cognitive change and C9ORF72 repeat expansion in the human ALS cortex; Authors - Zsofia I. Laszlo
rat	WB	Sci Rep; PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats.; Authors - Jing Li
zebrafish	IF	FASEB J; Emc1 is essential for vision and zebrafish photoreceptor outer segment morphogenesis; Authors - Tess McCann
zebrafish	WB	J Biol Chem; Pathogenic Mutations in Retinitis Pigmentosa 2 Predominantly Result in Loss of RP2 Protein Stability in Human and Zebrafish.; Authors - Fei Liu