GNB3 Polyclonal antibody

• 

  WB analysis using 10081-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10081-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse embryo using 10081-1-AP

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 10081-1-AP (GNB3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 10081-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver cancer using 10081-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10081-1-AP (GNB3 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HepG2 using 10081-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GNB3 antibody (10081-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

GNB3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10081-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse embryo tissue, rat brain tissue, mouse cerebellum tissue, mouse eye tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

10081-1-AP targets GNB3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0127

  Product name: Recombinant human GNB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC000115

  Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC000115
• Gene Symbol: GNB3
• Gene ID (NCBI): 2784
• RRID: AB_2263264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Neuron; Sustained antidepressant effects of ketamine metabolite involve GABAergic inhibition-mediated molecular dynamics in aPVT glutamatergic neurons; Authors - Ayako Kawatake-Kuno
mouse	IF	Elife; Injury-induced pulmonary tuft cells are heterogenous, arise independent of key Type 2 cytokines, and are dispensable for dysplastic repair; Authors - Justinn Barr
zebrafish	WB	Hum Mol Genet; CERKL gene knockout disturbs photoreceptor outer segment phagocytosis and causes rod-cone dystrophy in zebrafish.; Authors - Shanshan Yu
zebrafish	WB	J Biol Chem; Pathogenic Mutations in Retinitis Pigmentosa 2 Predominantly Result in Loss of RP2 Protein Stability in Human and Zebrafish.; Authors - Fei Liu
rat	WB	Sci Rep; PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats.; Authors - Jing Li
human	IF	Nat Commun; The immune landscape of human thymic epithelial tumors; Authors - Zhongwei Xin