GNGT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNGT2 Polyclonal antibody (11988-1-AP)

GNGT2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 11988-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

G gamma-C, G-gamma-8, G-gamma-9, GNG8, GNG9

• 

  WB analysis using 11988-1-AP

  Mouse retina tissue were subjected to SDS PAGE followed by western blot with 11988-1-AP (GNGT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 11988-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 11988-1-AP (GNGT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 11988-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 11988-1-AP (GNGT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 11988-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 11988-1-AP (GNGT2 antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse eye using 11988-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using GNGT2 antibody (11988-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse retina tissue
• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11988-1-AP targets GNGT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2618

  Product name: Recombinant human GNGT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-69 aa of BC008663

  Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

• Full Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
• Calculated Molecular Weight: 69 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC008663
• Gene Symbol: GNGT2
• Gene ID (NCBI): 2793
• RRID: AB_2877813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Generation of human pineal gland organoids with melatonin production for disease modeling; Authors - Ferdi Ridvan Kiral
mouse	WB	Toxicology; C-C motif chemokine ligand 5 contributes to radon exposure-induced lung injury by recruiting dendritic cells to activate effector T helper cells; Authors - Liping Ma
mouse	WB,IF	Inflamm Res; Gngt2 promotes inflammatory dendritic cell programming through an ATG5-NF-κB signaling axis in neutrophilic asthma.; Authors - Xiaoying Ji ; KD Validated