Tested Applications
Positive WB detected in | mouse retina tissue |
Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
11988-1-AP targets GNGT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2618 Product name: Recombinant human GNGT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC008663 Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS Predict reactive species |
Full Name | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 |
Calculated Molecular Weight | 69 aa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC008663 |
Gene Symbol | GNGT2 |
Gene ID (NCBI) | 2793 |
RRID | AB_2877813 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14610 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GNGT2 antibody 11988-1-AP | Download protocol |
IHC protocol for GNGT2 antibody 11988-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |