GOPC Polyclonal antibody

• 

  WB analysis using 12163-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12163-1-AP (GOPC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 12163-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12163-1-AP (GOPC antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HEK-293T using 12163-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293T cells using GOPC antibody (12163-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 12163-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using GOPC antibody (12163-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

GOPC Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12163-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PIST, GOPC1, Golgi-associated PDZ and coiled-coil motif-containing protein, FIG, CFTR-associated ligand

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-3 cells, mouse colon
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293T cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

12163-1-AP targets GOPC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2804

  Product name: Recombinant human GOPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC009553

  Sequence: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDD

• Full Name: golgi associated PDZ and coiled-coil motif containing
• Calculated Molecular Weight: 454 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC009553
• Gene Symbol: GOPC
• Gene ID (NCBI): 57120
• RRID: AB_2113182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD26
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GOPC (FIG/PIST/CAL) is a PDZ-domain scaffolding protein that regulates the trafficking of many integral membrane proteins, including cell surface receptors, ion channels and adhesion molecules. GOPC localizes to the trans-Golgi network (TGN) but not to the cis- or trans-Golgi cisternae, thus anti-GOPC can be used to label the TGN structure.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell Mol Life Sci; Golgi pH elevation due to loss of V-ATPase subunit V0a2 function correlates with tissue-specific glycosylation changes and globozoospermia; Authors - Johannes Kopp
human,mouse	WB	Environ Int; Repression of autophagy leads to acrosome biogenesis disruption caused by a sub-chronic oral administration of polystyrene nanoparticles.; Authors - Lixiao Zhou
mouse	WB	J Cell Mol Med; CCDC157 is essential for sperm differentiation and shows oligoasthenoteratozoospermia-related mutations in men; Authors - Huimei Zheng
mouse	IF	Elife; TMC7 deficiency causes acrosome biogenesis defects and male infertility in mice; Authors - Jing Wang