Product Information
30765-1-PBS targets GPAT3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33717 Product name: Recombinant human GPAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-136 aa of Glycerol-3-phosphate acyltransferase 3 Sequence: SEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQY* Predict reactive species |
| Full Name | 1-acylglycerol-3-phosphate O-acyltransferase 9 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | Glycerol-3-phosphate acyltransferase 3 |
| Gene Symbol | AGPAT9 |
| Gene ID (NCBI) | 84803 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q53EU6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.















