Product Information
30765-1-PBS targets GPAT3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag33717 Product name: Recombinant human GPAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-136 aa of Glycerol-3-phosphate acyltransferase 3 Sequence: SEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQY* Predict reactive species |
Full Name | 1-acylglycerol-3-phosphate O-acyltransferase 9 |
Calculated Molecular Weight | 49 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | Glycerol-3-phosphate acyltransferase 3 |
Gene Symbol | AGPAT9 |
Gene ID (NCBI) | 84803 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q53EU6 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.